PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G29090.1
Common NameLOC102703483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 812aa    MW: 87217 Da    PI: 6.0779
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G29090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox672.4e-21110165156
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   +++ +++t++q++eLe++F+++++p++++r+eL+k+l+L+ rqVk+WFqNrR+++k
  OB04G29090.1 110 KKRYHRHTPQQIQELEAMFKECPHPDEKQRAELSKRLRLEPRQVKFWFQNRRTQMK 165
                   678899***********************************************998 PP

2START164.86.2e-523235562206
                   HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCS.CHHHHHHHHHCCCGGCT-TT-S....EEE CS
         START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvd.mvlallveellddkeqWdetla....kae 80 
                   la +a++elvk+a+ +ep+W + +        es+n +e+l +f++  +     + +ea+r+sg+v+ +++a lve+l+d + +W+ ++     ka+
  OB04G29090.1 323 LAMSAMDELVKMAQMGEPLWITGAfgaaspakESLNFEEYLNTFPPCIGvkpegYVSEASRESGIVIiDDSAALVETLMDER-RWSDMFScmiaKAS 418
                   67899******************99*********************9999**************997256779*********.************** PP

                   EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--......-TTSEE-EESSEEEEEEEECTCEEEEE CS
         START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.....sssvvRaellpSgiliepksnghskvt 165
                   t+e is+g      gal lm+aelq+lsplvp R++ f+R+++ql++g w++vdvS d     +      +   + +++lpSg+++++++ng  kvt
  OB04G29090.1 419 TIEEISTGvagtrnGALLLMQAELQVLSPLVPiREVKFLRFSKQLSEGAWAVVDVSADGFMRDQGitsasTTANMNCRRLPSGCVMQDTPNGFVKVT 515
                   ********************************************************995333333333556667899******************** PP

                   EEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                   wveh++++++++h+l+r+l++sgla ga +w atlqrqce+
  OB04G29090.1 516 WVEHTEYDEASVHQLYRPLLRSGLALGAGRWIATLQRQCEC 556
                   ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-2491168IPR009057Homeodomain-like
SuperFamilySSF466893.93E-2199165IPR009057Homeodomain-like
PROSITE profilePS5007118.22107167IPR001356Homeobox domain
SMARTSM003891.1E-18108171IPR001356Homeobox domain
CDDcd000866.28E-20109165No hitNo description
PfamPF000468.1E-19110165IPR001356Homeobox domain
PROSITE patternPS000270142165IPR017970Homeobox, conserved site
PROSITE profilePS5084841.658313559IPR002913START domain
SuperFamilySSF559612.75E-25316556No hitNo description
CDDcd088752.05E-106317555No hitNo description
SMARTSM002344.3E-42322556IPR002913START domain
PfamPF018521.0E-43323556IPR002913START domain
SuperFamilySSF559612.2E-16576778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MSFGGGHFGD GVVAGGMQFP YSGAGPGVFT SSPALSLALV DAAGRGGSGG KMVTVIHGAK  60
ARDASEVENE MSRSGSDHLD VVSCGDVGGG GGGDEDEDED AEPGNPRKRK KRYHRHTPQQ  120
IQELEAMFKE CPHPDEKQRA ELSKRLRLEP RQVKFWFQNR RTQMKMQLER HENALLKQEN  180
DKLRTENLSI REAMANPVCG GCGGPAMLGE VSLEEHHLRV ENARLKDELS RVCALAAKFL  240
GKPISLMAPP KMHHQPHPMS GSSLELAVGG IGPMPSATMP VSTITDFAGA MSSSMGTVIT  300
PMKSAEAEPS AMAGIDKSLF LELAMSAMDE LVKMAQMGEP LWITGAFGAA SPAKESLNFE  360
EYLNTFPPCI GVKPEGYVSE ASRESGIVII DDSAALVETL MDERRWSDMF SCMIAKASTI  420
EEISTGVAGT RNGALLLMQA ELQVLSPLVP IREVKFLRFS KQLSEGAWAV VDVSADGFMR  480
DQGITSASTT ANMNCRRLPS GCVMQDTPNG FVKVTWVEHT EYDEASVHQL YRPLLRSGLA  540
LGAGRWIATL QRQCECLAIL MSSIALPEHD SIAIHPEGKR SMLKLARRMT KNFCAGVSTS  600
SAREWSKLDG LTGNIGEDVH VMAHKSVDEP GMPPGVVLSA ATSVWMPVMP HRLFNFLRNE  660
GLRAEWDILS NGGPMQEVTS IAKGQQDGNS VCLLKASPTN ANQNSMLILQ ETCADASGLM  720
VVYAPVDIPA MHLVMSGGDS TCVALLPSGF AILPAGPNTG ADHKMGSLLT VAFQILVNSQ  780
PTAKLTVESV ETVSNLISCT IKKIKTALRC DV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105111PRKRKKR
2106110RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1119140.0AK111914.1 Oryza sativa Japonica Group cDNA clone:J033128F17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652658.10.0PREDICTED: homeobox-leucine zipper protein ROC4
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLJ3M0I40.0J3M0I4_ORYBR; Uncharacterized protein
STRINGOB04G29090.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein